Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDihydrofolate reductase
LigandBDBM50035483
Substrate/Competitorn/a
Meas. Tech.ChEMBL_54966
IC50 28±n/a nM
Citation Rosowsky AMota CEWright JEQueener SF 2,4-Diamino-5-chloroquinazoline analogues of trimetrexate and piritrexim: synthesis and antifolate activity. J Med Chem 37:4522-8 (1995) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Dihydrofolate reductase
Name:Dihydrofolate reductase; P. carinii vs rat
Synonyms:Dihydrofolate reductase (DHFR) | Tetrahydrofolate dehydrogenase
Type:Enzyme
Mol. Mass.:21638.84
Organism:Rattus norvegicus (rat)
Description:n/a
Residue:187
Sequence:
MVRPLNCIVAVSQNMGIGKNGDLPWPLLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPQGAHFLAKSLDDALKLIEQPELASKVDMVWVVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLEKYKLLPEYPGVLSEIQEEKGIKYKF
EVYEKKD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50035483
n/a
NameBDBM50035483
Synonyms:5-Chloro-N*6*-(2,5-dimethoxy-benzyl)-quinazoline-2,4,6-triamine | 5-chloro-N6-(2,5-dimethoxybenzyl)quinazoline-2,4,6-triamine | 5-chloro-N~6~-(2,5-dimethoxybenzyl)quinazoline-2,4,6-triamine | CHEMBL138060
TypeSmall organic molecule
Emp. Form.C17H18ClN5O2
Mol. Mass.359.81
SMILESCOc1ccc(OC)c(CNc2ccc3nc(N)nc(N)c3c2Cl)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: