| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50035483 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_52852 (CHEMBL664376) |
|---|
| IC50 | 53±n/a nM |
|---|
| Citation |  Rosowsky, A; Mota, CE; Wright, JE; Queener, SF 2,4-Diamino-5-chloroquinazoline analogues of trimetrexate and piritrexim: synthesis and antifolate activity. J Med Chem37:4522-8 (1995) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DYR_PNECA | Dihydrofolate Reductase (DHFR) | Dihydrofolate reductase | Dihydrofolate reductase; P. carinii vs rat | Tetrahydrofolate dehydrogenase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 23891.29 |
|---|
| Organism: | Pneumocystis carinii |
|---|
| Description: | n/a |
|---|
| Residue: | 206 |
|---|
| Sequence: | MNQQKSLTLIVALTTSYGIGRSNSLPWKLKKEISYFKRVTSFVPTFDSFESMNVVLMGRK
TWESIPLQFRPLKGRINVVITRNESLDLGNGIHSAKSLDHALELLYRTYGSESSVQINRI
FVIGGAQLYKAAMDHPKLDRIMATIIYKDIHCDVFFPLKFRDKEWSSVWKKEKHSDLESW
VGTKVPHGKINEDGFDYEFEMWTRDL
|
|
|
|---|
| BDBM50035483 |
|---|
| n/a |
|---|
| Name | BDBM50035483 |
|---|
| Synonyms: | 5-Chloro-N*6*-(2,5-dimethoxy-benzyl)-quinazoline-2,4,6-triamine | 5-chloro-N6-(2,5-dimethoxybenzyl)quinazoline-2,4,6-triamine | 5-chloro-N~6~-(2,5-dimethoxybenzyl)quinazoline-2,4,6-triamine | CHEMBL138060 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H18ClN5O2 |
|---|
| Mol. Mass. | 359.81 |
|---|
| SMILES | COc1ccc(OC)c(CNc2ccc3nc(N)nc(N)c3c2Cl)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
