Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin 2a (5-HT2a) receptor
LigandBDBM50005836
Substrate/Competitorn/a
Meas. Tech.ChEMBL_2242
Ki 7.2±n/a nM
Citation Buchheit KHGamse RGiger RHoyer DKlein FKlöppner EPfannkuche HJMattes H The serotonin 5-HT4 receptor. 1. Design of a new class of agonists and receptor map of the agonist recognition site. J Med Chem 38:2326-30 (1995) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Serotonin 2a (5-HT2a) receptor
Name:Serotonin 2a (5-HT2a) receptor
Synonyms:5-HT2A
Type:Enzyme Catalytic Domain
Mol. Mass.:52578.24
Organism:BOVINE
Description:5-HT2A HTR2A BOVINE::Q75Z89
Residue:470
Sequence:
MDILCEENTSLSSTTNSLMQLHADTRLYSTDFNSGEGNTSNAFNWTVDSENRTNLSCEGC
LSPPCFSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSTLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADENFVLIGSF
VAFFIPLTIMVITYFLTIKSLQKEATLCVSDPGTRTKLASFSFLPQSSLSSEKLFQRSIH
REPGSYGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNRDVIEAL
LNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYKS
SQLQMGPKKNSKKDDKTTDNDCTMVALGKEHPEDAPADSSNTVNEKVSCV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50005836
n/a
NameBDBM50005836
Synonyms:4-Amino-5-chloro-N-{1-[3-(4-fluoro-phenoxy)-propyl]-3-methoxy-piperidin-4-yl}-2-methoxy-benzamide | 4-amino-5-chloro-N-(1-(3-(4-fluorophenoxy)propyl)-3-methoxypiperidin-4-yl)-2-methoxybenzamide | CHEMBL560739 | CISAPRIDE | PROPULSID | US10167299, Cisapride | US9221790, Cisapride | cid_5311047
TypeSmall organic molecule
Emp. Form.C23H29ClFN3O4
Mol. Mass.465.945
SMILESCOC1CN(CCCOc2ccc(F)cc2)CCC1NC(=O)c1cc(Cl)c(N)cc1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: