| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
|---|
| Ligand | BDBM50407405 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_204883 (CHEMBL808554) |
|---|
| Ki | 0.200000±n/a nM |
|---|
| Citation |  Frye, SV; Haffner, CD; Maloney, PR; Hiner, RN; Dorsey, GF; Noe, RA; Unwalla, RJ; Batchelor, KW; Bramson, HN; Stuart, JD Structure-activity relationships for inhibition of type 1 and 2 human 5 alpha-reductase and human adrenal 3 beta-hydroxy-delta 5-steroid dehydrogenase/3-keto-delta 5-steroid isomerase by 6-azaandrost-4-en-3-ones: optimization of the C17 substituent. J Med Chem38:2621-7 (1995) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
|---|
| Name: | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
|---|
| Synonyms: | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 | 5α-Reductase 1 (5α-R1) | S5A1_HUMAN | S5AR | SR type 1 | SRD5A1 | Steroid 5-alpha-reductase | Steroid 5-alpha-reductase 1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 29472.80 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P18405 |
|---|
| Residue: | 259 |
|---|
| Sequence: | MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQE
LPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMA
IMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGD
TGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWY
LRKFEEYPKFRKIIIPFLF
|
|
|
|---|
| BDBM50407405 |
|---|
| n/a |
|---|
| Name | BDBM50407405 |
|---|
| Synonyms: | CHEMBL2115222 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H29ClF6N2O2 |
|---|
| Mol. Mass. | 562.975 |
|---|
| SMILES | C[C@]12CC[C@H]3[C@@H](CN=C4C(Cl)C(=O)CC[C@]34C)[C@@H]1CC[C@@H]2C(=O)Nc1c(cccc1C(F)(F)F)C(F)(F)F |t:7| |
|---|
| Structure | 
|
|---|
Search and Browse
