Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-2B adrenergic receptor
LigandBDBM50030619
Substrate/Competitorn/a
Meas. Tech.ChEMBL_33355
Ki 14±n/a nM
Citation Ruffolo RRBondinell WHieble JP Alpha- and beta-adrenoceptors: from the gene to the clinic. 2. Structure-activity relationships and therapeutic applications. J Med Chem 38:3681-716 (1995) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Alpha-2B adrenergic receptor
Name:Alpha-2B adrenergic receptor
Synonyms:ADRA2B | ADRA2L1 | ADRA2L1 | ADRA2RL1 | Adrenergic alpha2B | Adrenergic receptor alpha | Adrenergic, alpha-2B-, receptor [Homo sapiens] | Alpha-2 adrenergic receptor subtype C2 | Alpha-2B adrenoceptor | Alpha-2B adrenoreceptor | Alpha-2BAR
Type:Enzyme
Mol. Mass.:49579.89
Organism:Homo sapiens (Human)
Description:P18089
Residue:450
Sequence:
MDHQDPYSVQATAAIAAAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADIL
VATLIIPFSLANELLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEY
NSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQGPQPRGRPQCKLNQEAWYILASSIGS
FFAPCLIMILVYLRIYLIAKRSNRRGPRAKGGPGQGESKQPRPDHGGALASAKLPALASV
ASAREVNGHSKSTGEKEEGETPEDTGTRALPPSWAALPNSGQGQKEGVCGASPEDEAEEE
EEEEEEEEECEPQAVPVSPASACSPPLQQPQGSRVLATLRGQVLLGRGVGAIGGQWWRRR
AQLTREKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPKHCKVPHGLFQFFFWIGYCNSS
LNPVIYTIFNQDFRRAFRRILCRPWTQTAW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50030619
n/a
NameBDBM50030619
Synonyms:1-Bromo-5-chloro-8-methyl-6,7,8,9-tetrahydro-2-oxa-8-aza-benzo[cd]azulene | CHEMBL123138 | SK&F-105854 | SK-105854
TypeSmall organic molecule
Emp. Form.C12H11BrClNO
Mol. Mass.300.579
SMILESCN1CCc2c(Cl)ccc3oc(Br)c(C1)c23
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: