Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-2C adrenergic receptor
LigandBDBM50030623
Substrate/Competitorn/a
Meas. Tech.ChEMBL_33532
Ki 64±n/a nM
Citation Ruffolo RRBondinell WHieble JP Alpha- and beta-adrenoceptors: from the gene to the clinic. 2. Structure-activity relationships and therapeutic applications. J Med Chem 38:3681-716 (1995) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Alpha-2C adrenergic receptor
Name:Adrenergic receptor alpha
Synonyms:Adrenergic alpha2C | Adrenergic receptor alpha | Adrenergic, alpha-2C-, receptor | Alpha-2 adrenergic receptor subtype C4 | Alpha-2C adrenoceptor | Alpha-2C adrenoreceptor | adrenergic, alpha-2C-, receptor [Homo sapiens]
Type:Enzyme
Mol. Mass.:49552.32
Organism:Homo sapiens (Human)
Description:P18825
Residue:462
Sequence:
MASPALAAALAVAAAAGPNASGAGERGSGGVANASGASWGPPRGQYSAGAVAGLAAVVGF
LIVFTVVGNVLVVIAVLTSRALRAPQNLFLVSLASADILVATLVMPFSLANELMAYWYFG
QVWCGVYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKATIVAVWLISA
VISFPPLVSLYRQPDGAAYPQCGLNDETWYILSSCIGSFFAPCLIMGLVYARIYRVAKLR
TRTLSEKRAPVGPDGASPTTENGLGAAAGAGENGHCAPPPADVEPDESSAAAERRRRRGA
LRRGGRRRAGAEGGAGGADGQGAGPGAAESGALTASRSPGPGGRLSRASSRSVEFFLSRR
RRARSSVCRRKVAQAREKRFTFVLAVVMGVFVLCWFPFFFSYSLYGICREACQVPGPLFK
FFFWIGYCNSSLNPVIYTVFNQDFRRSFKHILFRRRRRGFRQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50030623
n/a
NameBDBM50030623
Synonyms:6-Chloro-3-methyl-9-(3-methyl-but-2-enyloxy)-2,3,4,5-tetrahydro-1H-benzo[d]azepine | CHEMBL114166 | SK&F-104078 | SK-104078 | SKF 104078
TypeSmall organic molecule
Emp. Form.C16H22ClNO
Mol. Mass.279.805
SMILES[#6]-[#7]-1-[#6]-[#6]-c2c(Cl)ccc(-[#8]-[#6]\[#6]=[#6](\[#6])-[#6])c2-[#6]-[#6]-1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: