Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDopamine D2 receptor
LigandBDBM50048233
Substrate/Competitorn/a
Meas. Tech.ChEMBL_59154
Ki 0.700000±n/a nM
Citation Thurkauf AYuan JChen XWasley JWMeade RWoodruff KHHuston KRoss PC 1-Phenyl-3-(aminomethyl)pyrroles as potential antipsychotic agents. Synthesis and dopamine receptor binding. J Med Chem 38:4950-2 (1996) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Dopamine D2 receptor
Name:Dopamine D2 receptor
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:50619.11
Organism:Cercopithecus aethiops
Description:ChEMBL_59156
Residue:443
Sequence:
MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSKIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNADQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRSHLRAPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKNHPKIAKIFEIQTMPNGKTRTSLKTMSR
RKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSA
VNPIIYTTFNIEFRKAFLKILHC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50048233
n/a
NameBDBM50048233
Synonyms:1-(2-Methoxy-phenyl)-4-(1-phenyl-1H-pyrrol-3-ylmethyl)-piperazine | CHEMBL28321
TypeSmall organic molecule
Emp. Form.C22H25N3O
Mol. Mass.347.4534
SMILESCOc1ccccc1N1CCN(Cc2ccn(c2)-c2ccccc2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: