Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeutral Endopeptidase (NEP)
LigandBDBM50048304
Substrate/Competitorn/a
Meas. Tech.ChEMBL_144596
IC50 1.8±n/a nM
Citation Fink CAQiao YBerry CJSakane YGhai RDTrapani AJ New alpha-thiol dipeptide dual inhibitors of angiotensin-I converting enzyme and neutral endopeptidase EC 3.4.24.11. J Med Chem 38:5023-30 (1996) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Neutral Endopeptidase (NEP)
Name:Neprilysin
Synonyms:Neutral endopeptidase 24.11
Type:Protein
Mol. Mass.:85789.59
Organism:Rattus norvegicus (Rat)
Description:P07861
Residue:750
Sequence:
MGRSESQMDITDINAPKPKKKQRWTPLEISLSVLVLLLTIIAVTMIALYATYDDGICKSS
DCIKSAARLIQNMDASAEPCTDFFKYACGGWLKRNVIPETSSRYSNFDILRDELEVILKD
VLQEPKTEDIVAVQKAKTLYRSCINESAIDSRGGQPLLTLLPDIYGWPVASQNWEQTYGT
SWTAEKSIAQLNSKYGKKVLINFFVGTDDKNSTQHIIHFDQPRLGLPSRDYYECTGIYKE
ACTAYVDFMISVARLIRQEQRLPIDENQLSLEMNKVMELEKEIANATTKPEDRNDPMLLY
NKMTLAKLQNNFSLEINGKPFSWSNFTNEIMSTVNINIQNEEEVVVYAPEYLTKLKPILT
KYSPRDLQNLMSWRFIMDLVSSLSRNYKESRNAFRKALYGTTSETATWRRCANYVNGNME
NAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDLTWMDAETKKKAEEKALAIKERI
GYPDDIISNENKLNNEYLELNYKEEEYFENIIQNLKFSQSKQLKKLREKVDKDEWISGAA
VVNAFYSSGRNQIVFPAGILQPPFFSARQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKD
GDLVDWWTQQSANNFKDQSQCMVYQYGNFTWDLAGGQHLNGINTLGENIADNGGIGQAYR
AYQNYVKKNGEEKLLPGLDLNHKQLFFLNFAQVWCGTYRPEYAVNSIKTDVHSPGNFRII
GTLQNSAEFADAFHCRKNSYMNPERKCRVW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50048304
n/a
NameBDBM50048304
Synonyms:(S)-3-(4-Fluoro-phenyl)-2-{[1-((S)-2-mercapto-3-methyl-butyrylamino)-cyclopentanecarbonyl]-amino}-propionic acid | CHEMBL149364
TypeSmall organic molecule
Emp. Form.C20H27FN2O4S
Mol. Mass.410.503
SMILESCC(C)[C@H](S)C(=O)NC1(CCCC1)C(=O)N[C@@H](Cc1ccc(F)cc1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: