Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetthyroid beta
LigandBDBM50036402
Substrate/Competitorn/a
Meas. Tech.ChEMBL_143914
IC50 0.190000±n/a nM
Citation Yokoyama NWalker GNMain AJStanton JLMorrissey MMBoehm CEngle ANeubert ADWasvary JMStephan ZF Synthesis and structure-activity relationships of oxamic acid and acetic acid derivatives related to L-thyronine. J Med Chem 38:695-707 (1995) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
thyroid beta
Name:thyroid beta
Synonyms:Thyroid Hormone Receptor (TR-beta) | Thyroid hormone receptor beta | Thyroid hormone receptor beta-1
Type:Enzyme Catalytic Domain
Mol. Mass.:52661.52
Organism:RAT
Description:thyroid beta 0 RAT::P18113
Residue:461
Sequence:
MTPNSMTENRLPAWDKQKPHPDRGQDWKLVGMSEACLHRKSHVERRGALKNEQTSSHLIQ
ATWASSIFHLDPDDVNDQSVSSAQTFQTEEKKCKGYIPSYLDKDELCVVCGDKATGYHYR
CITCEGCKGFFRRTIQKSLHPSYSCKYEGKCIIDKVTRNQCQECRFKKCIYVGMATDLVL
DDSKRLAKRKLIEENREKRRREELQKSIGHKPEPTDEEWELIKTVTEAHVATNAQGSHWK
QKRKFLPEDIGQAPIVNAPEGGQVDLEAFSHFTKIITPAITRVVDFAKKLPMFCELPCED
QIILLKGCCMEIMSLRAAVRYDPDSETLTLNGEMAVTRGQLKNGGLGVVSDAIFDLGMSL
SSFNLDDTEVALLQAVLLMSSDRPGLACVERIEKYQDSFLLAFEHYINYRKHHVTHFWPK
LLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50036402
n/a
NameBDBM50036402
Synonyms:CHEMBL46882 | N-[3,5-dimethyl-4-(4'-hydroxy-3'-isopropylphenoxy)phenyl]oxamic acid | N-[4-(4-Hydroxy-3-isopropyl-phenoxy)-3,5-dimethyl-phenyl]-oxalamic acid
TypeSmall organic molecule
Emp. Form.C19H21NO5
Mol. Mass.343.3737
SMILESCC(C)c1cc(Oc2c(C)cc(NC(=O)C(O)=O)cc2C)ccc1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: