Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetthyroid beta
LigandBDBM50036405
Substrate/Competitorn/a
Meas. Tech.ChEMBL_143914
IC50 1.5±n/a nM
Citation Yokoyama NWalker GNMain AJStanton JLMorrissey MMBoehm CEngle ANeubert ADWasvary JMStephan ZF Synthesis and structure-activity relationships of oxamic acid and acetic acid derivatives related to L-thyronine. J Med Chem 38:695-707 (1995) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
thyroid beta
Name:thyroid beta
Synonyms:Thyroid Hormone Receptor (TR-beta) | Thyroid hormone receptor beta | Thyroid hormone receptor beta-1
Type:Enzyme Catalytic Domain
Mol. Mass.:52661.52
Organism:RAT
Description:thyroid beta 0 RAT::P18113
Residue:461
Sequence:
MTPNSMTENRLPAWDKQKPHPDRGQDWKLVGMSEACLHRKSHVERRGALKNEQTSSHLIQ
ATWASSIFHLDPDDVNDQSVSSAQTFQTEEKKCKGYIPSYLDKDELCVVCGDKATGYHYR
CITCEGCKGFFRRTIQKSLHPSYSCKYEGKCIIDKVTRNQCQECRFKKCIYVGMATDLVL
DDSKRLAKRKLIEENREKRRREELQKSIGHKPEPTDEEWELIKTVTEAHVATNAQGSHWK
QKRKFLPEDIGQAPIVNAPEGGQVDLEAFSHFTKIITPAITRVVDFAKKLPMFCELPCED
QIILLKGCCMEIMSLRAAVRYDPDSETLTLNGEMAVTRGQLKNGGLGVVSDAIFDLGMSL
SSFNLDDTEVALLQAVLLMSSDRPGLACVERIEKYQDSFLLAFEHYINYRKHHVTHFWPK
LLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50036405
n/a
NameBDBM50036405
Synonyms:CHEMBL434476 | N-(3,5-Dichloro-4-{3-[(4-chloro-phenyl)-hydroxy-methyl]-4-hydroxy-phenoxy}-phenyl)-oxalamic acid
TypeSmall organic molecule
Emp. Form.C21H14Cl3NO6
Mol. Mass.482.698
SMILESOC(c1ccc(Cl)cc1)c1cc(Oc2c(Cl)cc(NC(=O)C(O)=O)cc2Cl)ccc1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: