| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Integrase |
|---|
| Ligand | BDBM26658 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_90697 (CHEMBL702098) |
|---|
| IC50 | 76500±n/a nM |
|---|
| Citation |  Raghavan, K; Buolamwini, JK; Fesen, MR; Pommier, Y; Kohn, KW; Weinstein, JN Three-dimensional quantitative structure-activity relationship (QSAR) of HIV integrase inhibitors: a comparative molecular field analysis (CoMFA) study. J Med Chem38:890-7 (1995) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Integrase |
|---|
| Name: | Integrase |
|---|
| Synonyms: | Human immunodeficiency virus type 1 integrase |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 32231.48 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | ChEMBL_90865 |
|---|
| Residue: | 288 |
|---|
| Sequence: | FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED
|
|
|
|---|
| BDBM26658 |
|---|
| n/a |
|---|
| Name | BDBM26658 |
|---|
| Synonyms: | 2-(2,4-dihydroxyphenyl)-3,5,7-trihydroxy-1-benzopyran-4-one | 2-(2,4-dihydroxyphenyl)-3,5,7-trihydroxy-4H-chromen-4-one | 2-(2,4-dihydroxyphenyl)-3,5,7-trihydroxy-chromone | 2-(2,4-dihydroxyphenyl)-3,5,7-trihydroxychromen-4-one | 2-[2,4-bis(oxidanyl)phenyl]-3,5,7-tris(oxidanyl)chromen-4-one | CHEMBL28626 | MLS000069618 | Morin (19) | Morin (5) | Morin (Mor) | SMR000058259 | cid_5281670 | morin |
|---|
| Type | Flavonoid |
|---|
| Emp. Form. | C15H10O7 |
|---|
| Mol. Mass. | 302.2357 |
|---|
| SMILES | Oc1ccc(c(O)c1)-c1oc2cc(O)cc(O)c2c(=O)c1O |
|---|
| Structure | 
|
|---|
Search and Browse
