Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMetabotropic glutamate receptor 8
LigandBDBM17660
Substrate/Competitorn/a
Meas. Tech.ChEMBL_104621
EC50>100000±n/a nM
Citation Knöpfel TKuhn RAllgeier H Metabotropic glutamate receptors: novel targets for drug development. J Med Chem 38:1417-26 (1995) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Metabotropic glutamate receptor 8
Name:Metabotropic glutamate receptor 8
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:101846.09
Organism:Mus musculus
Description:ChEMBL_104621
Residue:908
Sequence:
MVCEGKRSTSCPCFFLLTAKFYWILTMMQRTHSQEYAHSIRLDGDIILGGLFPVHAKGER
GVPCGDLKKEKGIHRLEAMLYAIDQINKDPDLLSNITLGVRILDTCSRDTYALEQSLTFV
QALIEKDASDVKCANGDPPIFTKPDKISGVIGAAASSVSIMVANILRLFKIPQISYASTA
PELSDNTRYDFFSRVVPPDSYQAQAMVDIVTALGWNYVSTLASEGNYGESGVEAFTQISR
EIGGVCIAQSQKIPREPRPGEFEKIIKRLLETPNARAVIMFANEDDIRRILEAAKKLNQS
GHFLWIGSDSWGSKIAPVYQQEEIAEGAVTILPKRASIDGFDRYFRSRTLANNRRNVWFA
EFWEENFGCKLGSHGKRNSHIKKCTGLERIARDSSYEQEGKVQFVIDAVYSMAYALHNMH
KELCPGYIGLCPRMVTIDGKELLGYIRAVNFNGSAGTPVTFNENGDAPGRYDIFQYQINN
KSTEYKIIGHWTNQLHLKVEDMQWANREHTHPASVCSLPCKPGERKKTVKGVPCCWHCER
CEGYNYQVDELSCELCPLDQRPNINRTGCQRIPIIKLEWHSPWAVVPVFIAILGIIATTF
VIVTFVRYNDTPIVRASGRELSYVLLTGIFLCYSITFLMIAAPDTIICSFRRIFLGLGMC
FSYAALLTKTNRIHRIFEQGKKSVTAPKFISPASQLVITFSLISVQLLGVFVWFVVDPPH
TIIDYGEQRTLDPENARGVLKCDISDLSLICSLGYSILLMVTCTVYAIKTRGVPETFNEA
KPIGFTMYTTCIIWLAFIPIFFGTAQSAEKMYIQTTTLTVSMSLSASVSLGMLYMPKVYI
IIFHPEQNVQKRKRSFKAVVTAATMQSKLIQKGNDRPNGEVKSELCESLETNTSSTKTTY
ISYSNHSI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM17660
n/a
NameBDBM17660
Synonyms:(2S)-2-amino-3-(3,5-dioxo-1,2,4-oxadiazolidin-2-yl)propanoic acid | 2-amino-3-(3,5-dioxo[1,2,4]oxadiazolidin-2-yl)propionic acid | CHEMBL279956 | Quisqualate | Quisqualate, L | quisqualic acid
TypeSmall organic molecule
Emp. Form.C5H7N3O5
Mol. Mass.189.1262
SMILESN[C@@H](Cn1oc(=O)[nH]c1=O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: