| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM50029417 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_39446 (CHEMBL653022) |
|---|
| IC50 | >2000±n/a nM |
|---|
| Citation |  Campiani, G; Fiorini, I; De Filippis, MP; Ciani, SM; Garofalo, A; Nacci, V; Giorgi, G; Sega, A; Botta, M; Chiarini, A; Budriesi, R; Bruni, G; Romeo, MR; Manzoni, C; Mennini, T Cardiovascular characterization of pyrrolo[2,1-d][1,5]benzothiazepine derivatives binding selectively to the peripheral-type benzodiazepine receptor (PBR): from dual PBR affinity and calcium antagonist activity to novel and selective calcium entry blockers. J Med Chem39:2922-38 (1996) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
|---|
| Type: | Mitochondrion membrane protein |
|---|
| Mol. Mass.: | 18945.84 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
|---|
| Residue: | 169 |
|---|
| Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
|---|
| BDBM50029417 |
|---|
| n/a |
|---|
| Name | BDBM50029417 |
|---|
| Synonyms: | CHEMBL277363 | [4-(4-Methoxy-phenyl)-4H-benzo[b]pyrrolo[1,2-d][1,4]thiazin-1-ylmethyl]-dimethyl-amine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H22N2OS |
|---|
| Mol. Mass. | 350.477 |
|---|
| SMILES | COc1ccc(cc1)C1Sc2ccccc2-n2c(CN(C)C)ccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
