Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosylhomocysteinase
LigandBDBM50331791
Substrate/Competitorn/a
Meas. Tech.ChEMBL_196742
Ki 410±n/a nM
Citation Wnuk SFLiu SYuan CSBorchardt RTRobins MJ Inactivation of S-adenosyl-L-homocysteine hydrolase by amide and ester derivatives of adenosine-5'-carboxylic acid. J Med Chem 39:4162-6 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosylhomocysteinase
Name:Adenosylhomocysteinase
Synonyms:Adenosylhomocysteinase
Type:PROTEIN
Mol. Mass.:47714.06
Organism:Homo sapiens (Human)
Description:ChEMBL_1507791
Residue:432
Sequence:
MSDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIAGCLHMTVET
AVLIETLVTLGAEVQWSSCNIFSTQDHAAAAIAKAGIPVYAWKGETDEEYLWCIEQTLYF
KDGPLNMILDDGGDLTNLIHTKYPQLLPGIRGISEETTTGVHNLYKMMANGILKVPAINV
NDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVI
ITEIDPINALQAAMEGYEVTTMDEACQEGNIFVTTTGCIDIILGRHFEQMKDDAIVCNIG
HFDVEIDVKWLNENAVEKVNIKPQVDRYRLKNGRRIILLAEGRLVNLGCAMGHPSFVMSN
SFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMS
CDGPFKPDHYRY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50331791
n/a
NameBDBM50331791
Synonyms:(2S,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-3,4-dihydroxytetrahydrofuran-2-carboxylic acid | 5'-Carboxy adenosine | CHEMBL595547
TypeSmall organic molecule
Emp. Form.C10H11N5O5
Mol. Mass.281.2248
SMILESNc1ncnc2n(cnc12)[C@@H]1O[C@@H]([C@@H](O)[C@H]1O)C(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: