Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDihydroorotate dehydrogenase
LigandBDBM50054557
Substrate/Competitorn/a
Meas. Tech.ChEMBL_52873
IC50 50±n/a nM
Citation Kuo EAHambleton PTKay DPEvans PLMatharu SSLittle EMcDowall NJones CBHedgecock CJYea CMChan AWHairsine PWAger IRTully WRWilliamson RAWestwood R Synthesis, structure-activity relationships, and pharmacokinetic properties of dihydroorotate dehydrogenase inhibitors: 2-cyano-3-cyclopropyl-3-hydroxy-N-[3'-methyl-4'-(trifluoromethyl)phenyl ] propenamide and related compounds. J Med Chem 39:4608-21 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dihydroorotate dehydrogenase
Name:Dihydroorotate dehydrogenase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:42711.08
Organism:Mus musculus
Description:ChEMBL_1366444
Residue:395
Sequence:
MAWRQLRKRALDAAIILGGGGLLFTSYLTATGDDHFYAEYLMPALQRLLDPESAHRLAVR
VISLGLLPRATFQDSNMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKLGFGFVEVGSV
TPQPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSAVEHRLRARQQKQTQLTTDGLPLGIN
LGKNKTSVDAAADYVEGVRILGPLADYLVVNVSSPNTAGLRSLQGKTELRRLLSKVLQER
DALKGPQKPAVLVKIAPDLTAQDKEDIASVARELGIDGLIITNTTVSRPVGLQGALRSET
GGLSGKPLRDLSTQTIREMYALTQGTIPIIGVGGVSSGQDALEKIQAGASLVQLYTALTF
LGPPVVARVKRELEALLKERGFNTVTDAIGVDHRR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50054557
n/a
NameBDBM50054557
Synonyms:(Z)-2-Cyano-3-cyclopropyl-3-hydroxy-N-(4-nitro-phenyl)-acrylamide | CHEMBL344556
TypeSmall organic molecule
Emp. Form.C13H11N3O4
Mol. Mass.273.2441
SMILES[O-][N+](=O)c1ccc(NC(=O)C(=C=[N-])C(=[OH+])C2CC2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: