| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Phospholipase A2, membrane associated |
|---|
| Ligand | BDBM50015214 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_156362 (CHEMBL761692) |
|---|
| IC50 | 320000000±n/a nM |
|---|
| Citation |  Teshirogi, I; Matsutani, S; Shirahase, K; Fujii, Y; Yoshida, T; Tanaka, K; Ohtani, M Synthesis and phospholipase A2 inhibitory activity of thielocin B3 derivatives. J Med Chem39:5183-91 (1997) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Phospholipase A2, membrane associated |
|---|
| Name: | Phospholipase A2, membrane associated |
|---|
| Synonyms: | PA2GA_RAT | Phospholipase A2 group IIA | Pla2g2a |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 16307.95 |
|---|
| Organism: | Rattus norvegicus |
|---|
| Description: | ChEMBL_537135 |
|---|
| Residue: | 146 |
|---|
| Sequence: | MKVLLLLAVVIMAFGSIQVQGSLLEFGQMILFKTGKRADVSYGFYGCHCGVGGRGSPKDA
TDWCCVTHDCCYNRLEKRGCGTKFLTYKFSYRGGQISCSTNQDSCRKQLCQCDKAAAECF
ARNKKSYSLKYQFYPNKFCKGKTPSC
|
|
|
|---|
| BDBM50015214 |
|---|
| n/a |
|---|
| Name | BDBM50015214 |
|---|
| Synonyms: | 6-chloro-2-methoxy-9-acridinyl(4-diethylamino-1-methylbutyl)amine | 6-chloro-N-(5-(diethylamino)pentan-2-yl)-2-methoxyacridin-9-amine | CHEMBL7568 | N'-(6-chloro-2-methoxy-acridin-9-yl)-N,N-diethyl-pentane-1,4-diamine | N*4*-(6-Chloro-2-methoxy-acridin-9-yl)-N*1*,N*1*-diethyl-pentane-1,4-diamine | N*4*-(6-Chloro-2-methoxy-acridin-9-yl)-N*1*,N*1*-diethyl-pentane-1,4-diamine (Mepacrine) | N*4*-(6-Chloro-2-methoxy-acridin-9-yl)-N*1*,N*1*-diethyl-pentane-1,4-diamine ; (mepacrine) | N-(4-Hydroxy-phenyl)-acetamide | cid_237 | quinacrine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H30ClN3O |
|---|
| Mol. Mass. | 399.957 |
|---|
| SMILES | CCN(CC)CCCC(C)Nc1c2ccc(Cl)cc2nc2ccc(OC)cc12 |
|---|
| Structure | 
|
|---|
Search and Browse
