Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDelta-type opioid receptor
LigandBDBM50058153
Substrate/Competitorn/a
Meas. Tech.ChEMBL_146347
Ki 32±n/a nM
Citation Ohkawa SDiGiacomo BLarson DLTakemori AEPortoghese PS 7-Spiroindanyl derivatives of naltrexone and oxymorphone as selective ligands for delta opioid receptors. J Med Chem 40:1720-5 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Delta-type opioid receptor
Name:Opioid receptor
Synonyms:DOR-1 | Delta-type opioid receptor | K56 | MSL-2 | OPIATE Delta | OPRD1
Type:Enzyme Catalytic Domain
Mol. Mass.:40577.25
Organism:MOUSE
Description:OPIATE Delta OPRD1 MOUSE::P32300
Residue:372
Sequence:
MELVPSARAELQSSPLVNLSDAFPSAFPSAGANASGSPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTQPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRTPCGRQEPGSLRRPRQATTRERVTAC
TPSDGPGGGAAA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50058153
n/a
NameBDBM50058153
Synonyms:7-(5',6'-Benzo-2'-spiroindanyl)oxymorphone | CHEMBL297470
TypeSmall organic molecule
Emp. Form.C29H27NO4
Mol. Mass.453.529
SMILESCN1CCC23C4Oc5c2c(CC1[C@]3(O)CC1(Cc2cc3ccccc3cc2C1)C4=O)ccc5O |TLB:13:12:8.9.10:1.3.2,THB:7:8:12:1.3.2,0:1:12:8.9.10|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: