Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM383 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_159286 (CHEMBL764269) |
---|
IC50 | 0.030000±n/a nM |
---|
Citation | Smith, AB; Hirschmann, R; Pasternak, A; Yao, W; Sprengeler, PA; Holloway, MK; Kuo, LC; Chen, Z; Darke, PL; Schleif, WA An orally bioavailable pyrrolinone inhibitor of HIV-1 protease: computational analysis and X-ray crystal structure of the enzyme complex. J Med Chem40:2440-4 (1997) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM383 |
---|
n/a |
---|
Name | BDBM383 |
Synonyms: | (3S)-oxolan-3-yl N-[(2S,3S,5R)-5-benzyl-3-hydroxy-5-{[(1S,2R)-2-hydroxy-2,3-dihydro-1H-inden-1-yl]carbamoyl}-1-phenylpentan-2-yl]carbamate | Urethane deriv. 2 |
Type | Small organic molecule |
Emp. Form. | C33H38N2O6 |
Mol. Mass. | 558.6646 |
SMILES | O[C@@H](C[C@@H](Cc1ccccc1)C(=O)N[C@@H]1[C@H](O)Cc2ccccc12)[C@H](Cc1ccccc1)NC(=O)O[C@H]1CCOC1 |r| |
Structure |
|