| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Integrase |
|---|
| Ligand | BDBM50163744 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_90720 (CHEMBL701113) |
|---|
| IC50 | 120000±n/a nM |
|---|
| Citation |  Mazumder, A; Neamati, N; Sunder, S; Schulz, J; Pertz, H; Eich, E; Pommier, Y Curcumin analogs with altered potencies against HIV-1 integrase as probes for biochemical mechanisms of drug action. J Med Chem40:3057-63 (1997) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Integrase |
|---|
| Name: | Integrase |
|---|
| Synonyms: | Human immunodeficiency virus type 1 integrase |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 32231.48 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | ChEMBL_90865 |
|---|
| Residue: | 288 |
|---|
| Sequence: | FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED
|
|
|
|---|
| BDBM50163744 |
|---|
| n/a |
|---|
| Name | BDBM50163744 |
|---|
| Synonyms: | (1E,4Z,6E)-5-Hydroxy-1-(4-hydroxy-3-methoxy-phenyl)-7-(4-hydroxy-phenyl)-hepta-1,4,6-trien-3-one | (1E,6E)-1-(4-Hydroxy-3-methoxy-phenyl)-7-(4-hydroxy-phenyl)-hepta-1,6-diene-3,5-dione | 1-(4-hydroxy-3-methoxyphenyl)-7-(4-hydroxyphenyl)-1,6-heptadiene-3,5-dione | 5-hydroxy-7-(4-hydroxy-3-methoxyphenyl)-1-(4-hydroxyphenyl)hepta-1,4,6-trien-3-one | CHEMBL179512 | cid_5324476 | curcumin II | demethoxycurcumin |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H18O5 |
|---|
| Mol. Mass. | 338.3539 |
|---|
| SMILES | COc1cc(C=CC(=O)CC(=O)C=Cc2ccc(O)cc2)ccc1O |w:6.6,13.13| |
|---|
| Structure | 
|
|---|
Search and Browse
