Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTrypsin II
LigandBDBM50060041
Substrate/Competitorn/a
Meas. Tech.ChEMBL_212519
Ki 64±n/a nM
Citation Stürzebecher JPrasa DHauptmann JVieweg HWikström P Synthesis and structure-activity relationships of potent thrombin inhibitors: piperazides of 3-amidinophenylalanine. J Med Chem 40:3091-9 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Trypsin II
Name:Trypsin II
Synonyms:Anionic trypsin
Type:PROTEIN
Mol. Mass.:26281.39
Organism:Bos taurus
Description:ChEMBL_212177
Residue:247
Sequence:
MHPLLILAFVGAAVAFPSDDDDKIVGGYTCAENSVPYQVSLNAGYHFCGGSLINDQWVVS
AAHCYQYHIQVRLGEYNIDVLEGGEQFIDASKIIRHPKYSSWTLDNDILLIKLSTPAVIN
ARVSTLLLPSACASAGTECLISGWGNTLSSGVNYPDLLQCLVAPLLSHADCEASYPGQIT
NNMICAGFLEGGKDSCQGDSGGPVACNGQLQGIVSWGYGCAQKGKPGVYTKVCNYVDWIQ
ETIAANS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50060041
n/a
NameBDBM50060041
Synonyms:3-[3-(4-Hexanoyl-piperazin-1-yl)-2-(naphthalene-2-sulfonylamino)-3-oxo-propyl]-benzamidine | CHEMBL326013
TypeSmall organic molecule
Emp. Form.C30H37N5O4S
Mol. Mass.563.711
SMILESCCCCCC(=O)N1CCN(CC1)C(=O)C(Cc1cccc(c1)C(N)=N)NS(=O)(=O)c1ccc2ccccc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: