Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTissue-type plasminogen activator
LigandBDBM50060023
Substrate/Competitorn/a
Meas. Tech.ChEMBL_208245
Ki 110000±n/a nM
Citation Stürzebecher JPrasa DHauptmann JVieweg HWikström P Synthesis and structure-activity relationships of potent thrombin inhibitors: piperazides of 3-amidinophenylalanine. J Med Chem 40:3091-9 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tissue-type plasminogen activator
Name:Tissue-type plasminogen activator
Synonyms:Alteplase | Reteplase | Thrombin receptor protein | Tissue-type plasminogen activator | Tissue-type plasminogen activator (tPA) | Tissue-type plasminogen activator precursor | t-PA | t-Plasminogen Activator (tPA) | t-plasminogen activator
Type:Enzyme
Mol. Mass.:62931.08
Organism:Homo sapiens (Human)
Description:n/a
Residue:562
Sequence:
MDAMKRGLCCVLLLCGAVFVSPSQEIHARFRRGARSYQVICRDEKTQMIYQQHQSWLRPV
LRSNRVEYCWCNSGRAQCHSVPVKSCSEPRCFNGGTCQQALYFSDFVCQCPEGFAGKCCE
IDTRATCYEDQGISYRGTWSTAESGAECTNWNSSALAQKPYSGRRPDAIRLGLGNHNYCR
NPDRDSKPWCYVFKAGKYSSEFCSTPACSEGNSDCYFGNGSAYRGTHSLTESGASCLPWN
SMILIGKVYTAQNPSAQALGLGKHNYCRNPDGDAKPWCHVLKNRRLTWEYCDVPSCSTCG
LRQYSQPQFRIKGGLFADIASHPWQAAIFAKHRRSPGERFLCGGILISSCWILSAAHCFQ
ERFPPHHLTVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSRCA
QESSVVRTVCLPPADLQLPDWTECELSGYGKHEALSPFYSERLKEAHVRLYPSSRCTSQH
LLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMTLVGIISWGLGCGQK
DVPGVYTKVTNYLDWIRDNMRP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50060023
n/a
NameBDBM50060023
Synonyms:3-[(R)-3-(4-Formyl-piperazin-1-yl)-2-(naphthalene-2-sulfonylamino)-3-oxo-propyl]-benzamidine | CHEMBL322165
TypeSmall organic molecule
Emp. Form.C25H27N5O4S
Mol. Mass.493.578
SMILESNC(=N)c1cccc(C[C@@H](NS(=O)(=O)c2ccc3ccccc3c2)C(=O)N2CCN(CC2)C=O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: