Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThrombin
LigandBDBM50060031
Substrate/Competitorn/a
Meas. Tech.ChEMBL_210595
Ki 16±n/a nM
Citation Stürzebecher JPrasa DHauptmann JVieweg HWikström P Synthesis and structure-activity relationships of potent thrombin inhibitors: piperazides of 3-amidinophenylalanine. J Med Chem 40:3091-9 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Thrombin
Name:Thrombin
Synonyms:Activation peptide fragment 1 | Activation peptide fragment 2 | Coagulation factor II | Prothrombin | Thrombin heavy chain | Thrombin light chain
Type:Enzyme
Mol. Mass.:70502.73
Organism:Bos taurus (Bovine)
Description:P00735
Residue:625
Sequence:
MARVRGPRLPGCLALAALFSLVHSQHVFLAHQQASSLLQRARRANKGFLEEVRKGNLERE
CLEEPCSREEAFEALESLSATDAFWAKYTACESARNPREKLNECLEGNCAEGVGMNYRGN
VSVTRSGIECQLWRSRYPHKPEINSTTHPGADLRENFCRNPDGSITGPWCYTTSPTLRRE
ECSVPVCGQDRVTVEVIPRSGGSTTSQSPLLETCVPDRGREYRGRLAVTTSGSRCLAWSS
EQAKALSKDQDFNPAVPLAENFCRNPDGDEEGAWCYVADQPGDFEYCDLNYCEEPVDGDL
GDRLGEDPDPDAAIEGRTSEDHFQPFFNEKTFGAGEADCGLRPLFEKKQVQDQTEKELFE
SYIEGRIVEGQDAEVGLSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNF
TVDDLLVRIGKHSRTRYERKVEKISMLDKIYIHPRYNWKENLDRDIALLKLKRPIELSDY
IHPVCLPDKQTAAKLLHAGFKGRVTGWGNRRETWTTSVAEVQPSVLQVVNLPLVERPVCK
ASTRIRITDNMFCAGYKPGEGKRGDACEGDSGGPFVMKSPYNNRWYQMGIVSWGEGCDRD
GKYGFYTHVFRLKKWIQKVIDRLGS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50060031
n/a
NameBDBM50060031
Synonyms:3-[(R)-3-(4-Methyl-piperazin-1-yl)-2-(naphthalene-2-sulfonylamino)-3-oxo-propyl]-benzamidine | CHEMBL107911
TypeSmall organic molecule
Emp. Form.C25H29N5O3S
Mol. Mass.479.594
SMILESCN1CCN(CC1)C(=O)[C@@H](Cc1cccc(c1)C(N)=N)NS(=O)(=O)c1ccc2ccccc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: