Reaction Details |
| Report a problem with these data |
Target | Mu-type opioid receptor |
---|
Ligand | BDBM50454645 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_147101 (CHEMBL758266) |
---|
IC50 | >10000±n/a nM |
---|
Citation | Salvadori, S; Balboni, G; Guerrini, R; Tomatis, R; Bianchi, C; Bryant, SD; Cooper, PS; Lazarus, LH Evolution of the Dmt-Tic pharmacophore: N-terminal methylated derivatives with extraordinary delta opioid antagonist activity. J Med Chem40:3100-8 (1997) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mu-type opioid receptor |
---|
Name: | Mu-type opioid receptor |
Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 11165.58 |
Organism: | GUINEA PIG |
Description: | P97266 |
Residue: | 98 |
Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
BDBM50454645 |
---|
n/a |
---|
Name | BDBM50454645 |
Synonyms: | CHEMBL2370384 |
Type | Small organic molecule |
Emp. Form. | C24H29N3O5 |
Mol. Mass. | 439.5042 |
SMILES | CC(NC(=O)[C@@H]1Cc2ccccc2CN1C(=O)[C@@H](N)Cc1c(C)cc(O)cc1C)C(O)=O |
Structure |
|