| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50061306 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_157727 (CHEMBL763400) |
|---|
| Ki | 2±n/a nM |
|---|
| Citation |  Kaldor, SW; Kalish, VJ; Davies, JF; Shetty, BV; Fritz, JE; Appelt, K; Burgess, JA; Campanale, KM; Chirgadze, NY; Clawson, DK; Dressman, BA; Hatch, SD; Khalil, DA; Kosa, MB; Lubbehusen, PP; Muesing, MA; Patick, AK; Reich, SH; Su, KS; Tatlock, JH Viracept (nelfinavir mesylate, AG1343): a potent, orally bioavailable inhibitor of HIV-1 protease. J Med Chem40:3979-85 (1998) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50061306 |
|---|
| n/a |
|---|
| Name | BDBM50061306 |
|---|
| Synonyms: | (3S,4aS,8aS)-2-[(2R,3R)-2-Hydroxy-3-(3-hydroxy-2-methyl-benzoylamino)-4-phenylsulfanyl-butyl]-decahydro-isoquinoline-3-carboxylic acid tert-butylamide; compound with methanesulfonic acid | AG-1343 | CHEMBL1205 | NELFINAVIR MESYLATE | Nelfinavir | Viracept | cmdc.202100576, 24h |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C32H45N3O4S |
|---|
| Mol. Mass. | 567.782 |
|---|
| SMILES | Cc1c(O)cccc1C(=O)N[C@@H](CSc1ccccc1)[C@H](O)CN1C[C@H]2CCCC[C@H]2C[C@H]1C(=O)NC(C)(C)C |r| |
|---|
| Structure | 
|
|---|
Search and Browse
