Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 protease
LigandBDBM50061307
Substrate/Competitorn/a
Meas. Tech.ChEMBL_157727
Ki 3±n/a nM
Citation Kaldor SWKalish VJDavies JFShetty BVFritz JEAppelt KBurgess JACampanale KMChirgadze NYClawson DKDressman BAHatch SDKhalil DAKosa MBLubbehusen PPMuesing MAPatick AKReich SHSu KSTatlock JH Viracept (nelfinavir mesylate, AG1343): a potent, orally bioavailable inhibitor of HIV-1 protease. J Med Chem 40:3979-85 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 protease
Name:Human immunodeficiency virus type 1 protease
Synonyms:Pol polyprotein
Type:Enzyme Subunit
Mol. Mass.:10781.16
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50061307
n/a
NameBDBM50061307
Synonyms:AG-1254 | CHEMBL128696 | N-[(1R,2R)-3-(2-tert-Butylcarbamoyl-phenyl)-2-hydroxy-1-(naphthalen-2-ylsulfanylmethyl)-propyl]-3-hydroxy-2-methyl-benzamide
TypeSmall organic molecule
Emp. Form.C33H36N2O4S
Mol. Mass.556.715
SMILESCc1c(O)cccc1C(=O)N[C@@H](CSc1ccc2ccccc2c1)[C@H](O)Cc1ccccc1C(=O)NC(C)(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: