Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCCKBR
LigandBDBM50061830
Substrate/Competitorn/a
Meas. Tech.ChEMBL_48603
Ki 150±n/a nM
Citation Pierson MEComstock JMSimmons RDKaiser FJulien RZongrone JRosamond JD Synthesis and biological evaluation of potent, selective, hexapeptide CCK-A agonist anorectic agents. J Med Chem 40:4302-7 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
CCKBR
Name:Cholecystokinin receptor
Synonyms:Cholecystokinin A | Gastrin/cholecystokinin type B receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:48980.43
Organism:RAT
Description:Cholecystokinin A CCKBR RAT::P30553
Residue:452
Sequence:
MELLKLNRSVQGPGPGSGSSLCRPGVSLLNSSSAGNLSCDPPRIRGTGTRELEMAIRITL
YAVIFLMSVGGNVLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTF
IFGTVICKAISYLMGVSVSVSTLNLVAIALERYSAICRPLQARVWQTRSHAARVILATWL
LSGLLMVPYPVYTMVQPVGPRVLQCMHRWPSARVQQTWSVLLLLLLFFIPGVVIAVAYGL
ISRELYLGLHFDGENDSETQSRARNQGGLPGGAAPGPVHQNGGCRPVTSVAGEDSDGCCV
QLPRSRLEMTTLTTPTPGPVPGPRPNQAKLLAKKRVVRMLLVIVLLFFLCWLPVYSVNTW
RAFDGPGAQRALSGAPISFIHLLSYVSACVNPLVYCFMHRRFRQACLDTCARCCPRPPRA
RPQPLPDEDPPTPSIASLSRLSYTTISTLGPG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50061830
n/a
NameBDBM50061830
Synonyms:(R)-N-((S)-1-Carbamoyl-2-phenyl-ethyl)-3-{(S)-2-[(S)-3-(1H-indol-3-yl)-2-(2-{(S)-4-methylsulfanyl-2-[2-(4-sulfooxy-phenyl)-acetylamino]-butyrylamino}-acetylamino)-propionylamino]-4-methylsulfanyl-butyrylamino}-succinamic acid | CHEMBL341762
TypeSmall organic molecule
Emp. Form.C44H54N8O13S3
Mol. Mass.999.14
SMILESCSCC[C@H](NC(=O)Cc1ccc(OS(O)(=O)=O)cc1)C(=O)NCC(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CCSC)C(=O)N[C@H](CC(O)=O)C(=O)N[C@@H](Cc1ccccc1)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: