Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin 1d (5-HT1d) receptor
LigandBDBM50056944
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1956
Ki 9770±n/a nM
Citation el Ahmad YLaurent EMaillet PTalab ATeste JFDokhan RTran GOllivier R New benzocycloalkylpiperazines, potent and selective 5-HT1A receptor ligands. J Med Chem 40:952-60 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serotonin 1d (5-HT1d) receptor
Name:Serotonin 1d (5-HT1d) receptor
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:32680.56
Organism:Sus scrofa
Description:ChEMBL_1963
Residue:291
Sequence:
AMTDLLVSILVMPISIPYTITQTWSFGQLLCDIWLSSDITCCTASILHLCVIALDRYWAI
TDALEYSKRRTAGHAAAMIAIVWAISICISIPPLFWRQARAHEEISDCLVNTSQISYTIY
STCGAFYIPSLLLIILYGRIYRAARNRILNPPSLYGKRFTTAHLITGSAGSSLCSLNPSL
HEGHSHSAGSPLFFNHVKIKLADSVLERKRISAARERKATKTLGIILGAFIICWLPFFVA
SLVLPICRDSCWIHPALFDFFTWLGYLNSLINPIIYTVFNEEFRQAFQKVV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50056944
n/a
NameBDBM50056944
Synonyms:4-Fluoro-N-{2-[4-(1,2,3,4-tetrahydro-naphthalen-1-yl)-piperazin-1-yl]-ethyl}-benzamide | CHEMBL368061
TypeSmall organic molecule
Emp. Form.C23H28FN3O
Mol. Mass.381.4863
SMILESFc1ccc(cc1)C(=O)NCCN1CCN(CC1)C1CCCc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: