Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor
LigandBDBM50039843
Substrate/Competitorn/a
Meas. Tech.ChEMBL_138671
Ki 2.9±n/a nM
Citation Messer WSAbuh YFLiu YPeriyasamy SNgur DOEdgar MAEl-Assadi AASbeih SDunbar PGRoknich SRho TFang ZOjo BZhang HHuzl JJNagy PI Synthesis and biological characterization of 1,4,5,6-tetrahydropyrimidine and 2-amino-3,4,5,6-tetrahydropyridine derivatives as selective m1 agonists. J Med Chem 40:1230-46 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor
Name:Muscarinic acetylcholine receptor
Synonyms:Cholinergic receptor, muscarinic 1, CNS | Cholinergic, muscarinic | Muscarinic acetylcholine receptor M1
Type:Enzyme Catalytic Domain
Mol. Mass.:51400.50
Organism:Mus musculus
Description:Cholinergic, muscarinic 0 0::Q52KQ0
Residue:460
Sequence:
MNTSVPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVN
NYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS
FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYI
QFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSS
SERSQPGAEGSPESPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEV
VIKMPMVDPEAQAPTKQPPKSSPNTVKRPTKKGRDRGGKGQKPRGKEQLAKRKTFSLVKE
KKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTVNPMCYAL
CNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50039843
n/a
NameBDBM50039843
Synonyms:1,4,5,6-Tetrahydro-pyrimidine-5-carboxylic acid prop-2-ynyl ester; hydrochloride | CHEMBL542065
TypeSmall organic molecule
Emp. Form.C8H10N2O2
Mol. Mass.166.1772
SMILESO=C(OCC#C)C1CNC=NC1 |c:9|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: