Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSomatostatin receptor type 1
LigandBDBM50064772
Substrate/Competitorn/a
Meas. Tech.ChEMBL_200359
Ki 0.38±n/a nM
Citation Yang LGuo LPasternak AMosley RRohrer SBirzin EFoor FCheng KSchaeffer JPatchett AA Spiro[1H-indene-1,4'-piperidine] derivatives as potent and selective non-peptide human somatostatin receptor subtype 2 (sst2) agonists. J Med Chem 41:2175-9 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Somatostatin receptor type 1
Name:Somatostatin receptor type 1
Synonyms:SOMATOSTATIN SST1 | SRIF-2 | SS-1-R | SS1-R | SS1R | SSTR1 | Somatostatin receptor type 1 (SSTR1)
Type:Enzyme
Mol. Mass.:42692.81
Organism:Homo sapiens (Human)
Description:P30872
Residue:391
Sequence:
MFPNGTASSPSSSPSPSPGSCGEGGGSRGPGAGAADGMEEPGRNASQNGTLSEGQGSAIL
ISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLL
RHWPFGALLCRLVLSVDAVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLG
VWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQRWLVGFVLYTFLMGFLLPVGAIC
LCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQD
DATVSQLSVILGYANSCANPILYGFLSDNFKRSFQRILCLSWMDNAAEEPVDYYATALKS
RAYSVEDFQPENLESGGVFRNGTCTSRITTL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50064772
n/a
NameBDBM50064772
Synonyms:Ala-Gly-cyclo[Cys-Lys-Asn-Phe-Phe-Trp-Lys-Thr-Phe-Thr-Ser-Cys] (SRIF14) | CHEMBL408362
TypeSmall organic molecule
Emp. Form.C76H104N18O19S2
Mol. Mass.1637.878
SMILESC[C@@H](O)[C@H]1NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@@H](Cc2c[nH]c3ccccc23)NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](CCCCN)NC(=O)[C@@H](CSSC[C@H](NC(=O)[C@H](CO)NC1=O)C(O)=O)NC(=O)CNC(=O)[C@H](C)N)[C@@H](C)O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: