| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Delta-type opioid receptor |
|---|
| Ligand | BDBM50065353 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_145498 (CHEMBL752140) |
|---|
| Ki | 2.1±n/a nM |
|---|
| Citation |  Shreder, K; Zhang, L; Dang, T; Yaksh, TL; Umeno, H; DeHaven, R; Daubert, J; Goodman, M Synthesis and biological activity of a novel methylamine-bridged enkephalin analogue (MABE): a new route to cyclic peptides and peptidomimetics. J Med Chem41:2631-5 (1998) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Delta-type opioid receptor |
|---|
| Name: | Delta-type opioid receptor |
|---|
| Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40382.98 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
|---|
| Residue: | 372 |
|---|
| Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
|---|
| BDBM50065353 |
|---|
| n/a |
|---|
| Name | BDBM50065353 |
|---|
| Synonyms: | (S)-2-Amino-N-((6S,12R)-6-benzyl-1-methyl-5,8,11-trioxo-1,4,7,10tetraaza-cyclotridec-12-yl)-3-(4-hydroxy-phenyl)-propionamide | CHEMBL88560 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H34N6O5 |
|---|
| Mol. Mass. | 510.5854 |
|---|
| SMILES | CN1CCNC(=O)[C@H](Cc2ccccc2)NC(=O)CNC(=O)[C@@H](C1)NC(=O)[C@@H](N)Cc1ccc(O)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
