Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetP2Y purinoceptor 1
LigandBDBM50062283
Substrate/Competitorn/a
Meas. Tech.ChEMBL_162504
IC50 2110±n/a nM
Citation Camaioni EBoyer JLMohanram AHarden TKJacobson KA Deoxyadenosine bisphosphate derivatives as potent antagonists at P2Y1 receptors. J Med Chem 41:183-90 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
P2Y purinoceptor 1
Name:P2Y purinoceptor 1
Synonyms:n/a
Type:n/a
Mol. Mass.:41199.64
Organism:Meleagris gallopavo
Description:n/a
Residue:362
Sequence:
MTEALISAALNGTQPELLAGGWAAGNASTKCSLTKTGFQFYYLPTVYILVFITGFLGNSV
AIWMFVFHMRPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFGDVMCKLQRFIF
HVNLYGSILFLTCISVHRYTGVVHPLKSLGRLKKKNAVYVSSLVWALVVAVIAPILFYSG
TGVRRNKTITCYDTTADEYLRSYFVYSMCTTVFMFCIPFIVILGCYGLIVKALIYKDLDN
SPLRRKSIYLVIIVLTVFAVSYLPFHVMKTLNLRARLDFQTPQMCAFNDKVYATYQVTRG
LASLNSCVDPILYFLAGDTFRRRLSRATRKSSRRSEPNVQSKSEEMTLNILTEYKQNGDT
SL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50062283
n/a
NameBDBM50062283
Synonyms:CHEMBL43531 | Phosphoric acid mono-[5-(6-amino-2-methylsulfanyl-purin-9-yl)-2-phosphonooxymethyl-tetrahydro-furan-3-yl] ester
TypeSmall organic molecule
Emp. Form.C11H17N5O9P2S
Mol. Mass.457.293
SMILESCSc1nc(N)c2ncn(C3CC(OP(O)(O)=O)C(COP(O)(O)=O)O3)c2n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: