Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDOPAMINE
LigandBDBM50066910
Substrate/Competitorn/a
Meas. Tech.ChEMBL_58649
Ki 16±n/a nM
Citation Campiani GNacci VBechelli SCiani SMGarofalo AFiorini IWikström Hde Boer PLiao YTepper PGCagnotto AMennini T New antipsychotic agents with serotonin and dopamine antagonist properties based on a pyrrolo[2,1-b][1,3]benzothiazepine structure. J Med Chem 41:3763-72 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
DOPAMINE
Name:Dopamine receptors; D1 & D2
Synonyms:D(1A) dopamine receptor | DOPAMINE D1 | Dopamine D1 high | Dopamine D1 low | Dopamine receptor | Dopamine receptor D1 | Dopamine1-like
Type:Enzyme Catalytic Domain
Mol. Mass.:49429.75
Organism:RAT
Description:DOPAMINE 0 RAT::P18901
Residue:446
Sequence:
MAPNTSTMDEAGLPAERDFSFRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTNF
FVISLAVSDLLVAVLVMPWKAVAEIAGFWPLGPFCNIWVAFDIMCSTASILNLCVISVDR
YWAISSPFQYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTWPLDGNFTSLED
TEDDNCDTRLSRTYAISSSLISFYIPVAIMIVTYTSIYRIAQKQIRRISALERAAVHAKN
CQTTAGNGNPVECAQSESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFISNCMVPFCGS
EETQPFCIDSITFDVFVWFGWANSSLNPIIYAFNADFQKAFSTLLGCYRLCPTTNNAIET
VSINNNGAVVFSSHHEPRGSISKDCNLVYLIPHAVGSSEDLKKEEAGGIAKPLEKLSPAL
SVILDYDTDVSLEKIQPVTHSGQHST
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50066910
n/a
NameBDBM50066910
Synonyms:(+/-)7-Chloro-9-(4-methyl-piperazin-1-yl)-9,10-dihydro-4-thia-10a-aza-benzo[f]azulene | (R)-(-)7-Chloro-9-(4-methyl-piperazin-1-yl)-9,10-dihydro-4-thia-10a-aza-benzo[f]azulene | (S)-(+)-7-Chloro-9-(4-methyl-piperazin-1-yl)-9,10-dihydro-4-thia-10a-aza-benzo[f]azulene(ST1460) | 7-Chloro-9-(4-methyl-piperazin-1-yl)-9,10-dihydro-4-thia-10a-aza-benzo[f]azulene | CHEMBL120512
TypeSmall organic molecule
Emp. Form.C17H20ClN3S
Mol. Mass.333.879
SMILESCN1CCN(CC1)C1Cn2cccc2Sc2ccc(Cl)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: