Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCholine Acetyltransferase
LigandBDBM8961
Substrate/Competitorn/a
Meas. Tech.ChEMBL_27380
Ki 0.15±n/a nM
Citation Melchiorre CAndrisano VBolognesi MLBudriesi RCavalli ACavrini VRosini MTumiatti VRecanatini M Acetylcholinesterase noncovalent inhibitors based on a polyamine backbone for potential use against Alzheimer's disease. J Med Chem 41:4186-9 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Choline Acetyltransferase
Name:Choline acetylase
Synonyms:Choline O-acetyltransferase
Type:Enzyme Catalytic Domain
Mol. Mass.:71875.58
Organism:RAT
Description:Choline Acetyltransferase 0 RAT::P32738
Residue:640
Sequence:
MPILEKAPQKMPVKASSWEELDLPKLPVPPLQQTLATYLQCMQHLVPEEQFRKSQAIVKR
FGAPGGLGETLQEKLLERQEKTANWVSEYWLNDMYLNNRLALPVNSSPAVIFARQHFQDT
NDQLRFAACLISGVLSYKTLLDSHSLPTDWAKGQLSGQPLCMKQYYRLFSSYRLPGHTQD
TLVAQKSSIMPEPEHVIVACCNQFFVLDVVINFRRLSEGDLFTQLRKIVKMASNEDERLP
PIGLLTSDGRSEWAKARTVLLKDSTNRDSLDMIERCICLVCLDGPGTGELSDTHRALQLL
HGGGCSLNGANRWYDKSLQFVVGRDGTCGVVCEHSPFDGIVLVQCTEHLLKHMMTSNKKL
VRADSVSELPAPRRLRLKCSPETQGHLASSAEKLQRIVKNLDFIVYKFDNYGKTFIKKQK
YSPDGFIQVALQLAYYRLYQRLVPTYESASIRRFQEGRVDNIRSATPEALAFVQAMTDHK
AAMPASEKLQLLQTAMQAHKQYTVMAITGMAIDNHLLALRELARDLCKEPPEMFMDETYL
MSNRFVLSTSQVPTTMEMFCCYGPVVPNGNGACYNPQPEAITFCISSFHSCKETSSVEFA
EAVGASLVDMRDLCSSRQPADSKPPAPKEKARGPSQAKQS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM8961
n/a
NameBDBM8961
Synonyms:1,2,3,4-tetrahydro-9-acridinamine | 1,2,3,4-tetrahydroacridin-9-amine | 9-THA | 9-amino-1,2,3,4-tetrahydroacridine (THA) | CHEMBL1337960 | CHEMBL95 | Cognex | Tacrine | Tracine | US8999994, Tacrine | cid_1935 | tacrine.HCl
TypeSmall organic molecule
Emp. Form.C13H14N2
Mol. Mass.198.2637
SMILESNc1c2CCCCc2nc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: