| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cannabinoid receptor 2 |
|---|
| Ligand | BDBM50068668 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_46832 (CHEMBL657301) |
|---|
| Ki | 658±n/a nM |
|---|
| Citation |  Reggio, PH; Basu-Dutt, S; Barnett-Norris, J; Castro, MT; Hurst, DP; Seltzman, HH; Roche, MJ; Gilliam, AF; Thomas, BF; Stevenson, LA; Pertwee, RG; Abood, ME The bioactive conformation of aminoalkylindoles at the cannabinoid CB1 and CB2 receptors: insights gained from (E)- and (Z)-naphthylidene indenes. J Med Chem41:5177-87 (1999) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cannabinoid receptor 2 |
|---|
| Name: | Cannabinoid receptor 2 |
|---|
| Synonyms: | CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CNR2_HUMAN | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 39690.94 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P34972 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
|
|
|
|---|
| BDBM50068668 |
|---|
| n/a |
|---|
| Name | BDBM50068668 |
|---|
| Synonyms: | 4-(2-{2-Methyl-3-[1-naphthalen-1-yl-meth-(E)-ylidene]-3H-inden-1-yl}-ethyl)-morpholine | CHEMBL149599 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H27NO |
|---|
| Mol. Mass. | 381.5094 |
|---|
| SMILES | CC1=C(CCN2CCOCC2)c2ccccc2\C1=C/c1cccc2ccccc12 |c:1| |
|---|
| Structure | 
|
|---|
Search and Browse
