Reaction Details |
| Report a problem with these data |
Target | Delta-type opioid receptor |
---|
Ligand | BDBM60212 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_147026 (CHEMBL753667) |
---|
Ki | 95±n/a nM |
---|
Citation | Thomas, JB; Fall, MJ; Cooper, JB; Rothman, RB; Mascarella, SW; Xu, H; Partilla, JS; Dersch, CM; McCullough, KB; Cantrell, BE; Zimmerman, DM; Carroll, FI Identification of an opioid kappa receptor subtype-selective N-substituent for (+)-(3R,4R)-dimethyl-4-(3-hydroxyphenyl)piperidine. J Med Chem41:5188-97 (1999) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Delta-type opioid receptor |
---|
Name: | Delta-type opioid receptor |
Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40382.98 |
Organism: | Homo sapiens (Human) |
Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
Residue: | 372 |
Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
BDBM60212 |
---|
n/a |
---|
Name | BDBM60212 |
Synonyms: | (4R,4aS,7aR,12bS)-3-(cyclopropylmethyl)-4a,9-bis(oxidanyl)-2,4,5,6,7a,13-hexahydro-1H-4,12-methanobenzofuro[3,2-e]isoquinoline-7-one;hydrochloride | (4R,4aS,7aR,12bS)-3-(cyclopropylmethyl)-4a,9-dihydroxy-2,4,5,6,7a,13-hexahydro-1H-4,12-methanobenzofuro[3,2-e]isoquinoline-7-one;hydrochloride | MLS000069607 | NALTREXONE HYDROCHLORIDE | SMR000058767 | US10988481, Compound NTX | US9107954, naltrexone | cid_5485201 |
Type | Small organic molecule |
Emp. Form. | C20H23NO4 |
Mol. Mass. | 341.4009 |
SMILES | Oc1ccc2C[C@H]3N(CC4CC4)CC[C@@]45[C@@H](Oc1c24)C(=O)CC[C@@]35O |
Structure |
|