Reaction Details |
| Report a problem with these data |
Target | Mu-type opioid receptor |
---|
Ligand | BDBM50291970 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_145302 (CHEMBL752837) |
---|
Ki | 0.039000±n/a nM |
---|
Citation | Thomas, JB; Fall, MJ; Cooper, JB; Rothman, RB; Mascarella, SW; Xu, H; Partilla, JS; Dersch, CM; McCullough, KB; Cantrell, BE; Zimmerman, DM; Carroll, FI Identification of an opioid kappa receptor subtype-selective N-substituent for (+)-(3R,4R)-dimethyl-4-(3-hydroxyphenyl)piperidine. J Med Chem41:5188-97 (1999) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mu-type opioid receptor |
---|
Name: | Mu-type opioid receptor |
Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 11165.58 |
Organism: | GUINEA PIG |
Description: | P97266 |
Residue: | 98 |
Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
BDBM50291970 |
---|
n/a |
---|
Name | BDBM50291970 |
Synonyms: | 3-[(3S,4S)-3,4-Dimethyl-1-((E)-3-phenyl-allyl)-piperidin-4-yl]-phenol | CHEMBL150052 |
Type | Small organic molecule |
Emp. Form. | C22H27NO |
Mol. Mass. | 321.4559 |
SMILES | C[C@@H]1CN(C\C=C\c2ccccc2)CC[C@]1(C)c1cccc(O)c1 |
Structure |
|