| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Endothelin receptor type B |
|---|
| Ligand | BDBM50068720 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_64185 (CHEMBL878144) |
|---|
| Ki | 940±n/a nM |
|---|
| Citation |  Murugesan, N; Gu, Z; Stein, PD; Bisaha, S; Spergel, S; Girotra, R; Lee, VG; Lloyd, J; Misra, RN; Schmidt, J; Mathur, A; Stratton, L; Kelly, YF; Bird, E; Waldron, T; Liu, EC; Zhang, R; Lee, H; Serafino, R; Abboa-Offei, B; Mathers, P; Giancarli, M; Seymour, AA; Webb, ML; Hunt, JT Biphenylsulfonamide endothelin antagonists: structure-activity relationships of a series of mono- and disubstituted analogues and pharmacology of the orally active endothelin antagonist 2'-amino-N- (3,4-dimethyl-5-isoxazolyl)-4'-(2-methylpropyl)[1, 1'-biphenyl]-2-sulfonamide (BMS-187308). J Med Chem41:5198-218 (1999) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Endothelin receptor type B |
|---|
| Name: | Endothelin receptor type B |
|---|
| Synonyms: | EDNRB_RAT | ENDOTHELIN B | ET-B | Ednrb | Endothelin receptor | Endothelin receptor non-selective type |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 49483.43 |
|---|
| Organism: | RAT |
|---|
| Description: | ENDOTHELIN B EDNRB RAT::P21451 |
|---|
| Residue: | 442 |
|---|
| Sequence: | MQSSASRCGRALVALLLACGLLGVWGEKRGFPPAQATPSLLGTKEVMTPPTKTSWTRGSN
SSLMRSSAPAEVTKGGRVAGVPPRSFPPPCQRKIEINKTFKYINTIVSCLVFVLGIIGNS
TLLRIIYKNKCMRNGPNILIASLALGDLLHIIIDIPINAYKLLAGDWPFGAEMCKLVPFI
QKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGF
DVITSDYKGKPLRVCMLNPFQKTAFMQFYKTAKDWWLFSFYFCLPLAITAIFYTLMTCEM
LRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYDQSNPQRCEL
LSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQTFEEKQSLEEKQSC
LKFKANDHGYDNFRSSNKYSSS
|
|
|
|---|
| BDBM50068720 |
|---|
| n/a |
|---|
| Name | BDBM50068720 |
|---|
| Synonyms: | 6-Hydroxy-4'-isobutyl-biphenyl-2-sulfonic acid (3,4-dimethyl-isoxazol-5-yl)-amide | CHEMBL421955 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H24N2O4S |
|---|
| Mol. Mass. | 400.491 |
|---|
| SMILES | CC(C)Cc1ccc(cc1)-c1c(O)cccc1S(=O)(=O)Nc1onc(C)c1C |
|---|
| Structure | 
|
|---|
Search and Browse
