Reaction Details |
| Report a problem with these data |
Target | Methylated-DNA--protein-cysteine methyltransferase |
---|
Ligand | BDBM50068783 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_144712 (CHEMBL751007) |
---|
IC50 | 120±n/a nM |
---|
Citation | McElhinney, RS; Donnelly, DJ; McCormick, JE; Kelly, J; Watson, AJ; Rafferty, JA; Elder, RH; Middleton, MR; Willington, MA; McMurry, TB; Margison, GP Inactivation of O6-alkylguanine-DNA alkyltransferase. 1. Novel O6-(hetarylmethyl)guanines having basic rings in the side chain. J Med Chem41:5265-71 (1999) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Methylated-DNA--protein-cysteine methyltransferase |
---|
Name: | Methylated-DNA--protein-cysteine methyltransferase |
Synonyms: | 6-O-methylguanine-DNA methyltransferase | MGMT | MGMT_HUMAN |
Type: | PROTEIN |
Mol. Mass.: | 21651.27 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_144711 |
Residue: | 207 |
Sequence: | MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLM
QCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAAL
AGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPG
LGGSSGLAGAWLKGAGATSGSPPAGRN
|
|
|
BDBM50068783 |
---|
n/a |
---|
Name | BDBM50068783 |
Synonyms: | 6-(Furan-2-ylmethoxy)-6,9-dihydro-1H-purin-2-ylamine | CHEMBL146768 |
Type | Small organic molecule |
Emp. Form. | C10H11N5O2 |
Mol. Mass. | 233.2266 |
SMILES | NC1=Nc2nc[nH]c2C(N1)OCc1ccco1 |t:1| |
Structure |
|