| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50000066 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_201897 (CHEMBL808188) |
|---|
| Ki | 0.17±n/a nM |
|---|
| Citation |  Moriarty, RM; Enache, LA; Zhao, L; Gilardi, R; Mattson, MV; Prakash, O Rigid phencyclidine analogues. Binding to the phencyclidine and sigma 1 receptors. J Med Chem41:468-77 (1998) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25266.54 |
|---|
| Organism: | RAT |
|---|
| Description: | Q9R0C9 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50000066 |
|---|
| n/a |
|---|
| Name | BDBM50000066 |
|---|
| Synonyms: | (2-Azepan-1-yl-ethyl)-[2-(3,4-dichloro-phenyl)-ethyl]-methyl-amine | CHEMBL356688 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H26Cl2N2 |
|---|
| Mol. Mass. | 329.308 |
|---|
| SMILES | CN(CCN1CCCCCC1)CCc1ccc(Cl)c(Cl)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
