Reaction Details |
| Report a problem with these data |
Target | Serine protease 1 |
---|
Ligand | BDBM50079212 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_212880 (CHEMBL824708) |
---|
Ki | 260±n/a nM |
---|
Citation | Quan, ML; Liauw, AY; Ellis, CD; Pruitt, JR; Carini, DJ; Bostrom, LL; Huang, PP; Harrison, K; Knabb, RM; Thoolen, MJ; Wong, PC; Wexler, RR Design and synthesis of isoxazoline derivatives as factor Xa inhibitors. 1. J Med Chem42:2752-9 (1999) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Serine protease 1 |
---|
Name: | Serine protease 1 |
Synonyms: | Alpha-trypsin chain 1 | Alpha-trypsin chain 2 | Beta-trypsin | Cationic trypsinogen | PRSS1 | Serine protease 1 | TRP1 | TRY1 | TRY1_HUMAN | TRYP1 | Thrombin & trypsin | Trypsin | Trypsin I | Trypsin-1 |
Type: | Enzyme |
Mol. Mass.: | 26557.80 |
Organism: | Homo sapiens (Human) |
Description: | P07477 |
Residue: | 247 |
Sequence: | MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVS
AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVIN
ARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKIT
SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIK
NTIAANS
|
|
|
BDBM50079212 |
---|
n/a |
---|
Name | BDBM50079212 |
Synonyms: | CHEMBL93227 | [3-(3-Carbamimidoyl-phenyl)-5-(2'-methylsulfanyl-biphenyl-4-ylcarbamoyl)-4,5-dihydro-isoxazol-5-yl]-acetic acid methyl ester; TFA |
Type | Small organic molecule |
Emp. Form. | C27H26N4O4S |
Mol. Mass. | 502.585 |
SMILES | COC(=O)CC1(CC(=NO1)c1cccc(c1)C(N)=N)C(=O)Nc1ccc(cc1)-c1ccccc1SC |c:7| |
Structure |
|