Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTrypsin-1
LigandBDBM50079211
Substrate/Competitorn/a
Meas. Tech.ChEMBL_212880
Ki 130±n/a nM
Citation Quan MLLiauw AYEllis CDPruitt JRCarini DJBostrom LLHuang PPHarrison KKnabb RMThoolen MJWong PCWexler RR Design and synthesis of isoxazoline derivatives as factor Xa inhibitors. 1. J Med Chem 42:2752-9 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Trypsin-1
Name:Trypsin-1
Synonyms:Alpha-trypsin chain 1 | Alpha-trypsin chain 2 | Beta-trypsin | Cationic trypsinogen | PRSS1 | Serine protease 1 | Trypsin | Trypsin I
Type:Enzyme
Mol. Mass.:26557.80
Organism:Homo sapiens (Human)
Description:P07477
Residue:247
Sequence:
MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVS
AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVIN
ARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKIT
SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIK
NTIAANS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50079211
n/a
NameBDBM50079211
Synonyms:CHEMBL327404 | {3-(3-Carbamimidoyl-phenyl)-5-[5-(2-sulfamoyl-phenyl)-pyridin-2-ylcarbamoyl]-4,5-dihydro-isoxazol-5-yl}-acetic acid methyl ester; TFA
TypeSmall organic molecule
Emp. Form.C25H24N6O6S
Mol. Mass.536.56
SMILESCOC(=O)CC1(CC(=NO1)c1cccc(c1)C(N)=N)C(=O)Nc1ccc(cn1)-c1ccccc1S(N)(=O)=O |c:7|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: