Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H2 receptor
LigandBDBM50010859
Substrate/Competitorn/a
Meas. Tech.ChEMBL_85065
IC50 1900±n/a nM
Citation Quiñones-Torrelo CSagrado SVillanueva-Camañas RMMedina-Hernández MJ Development of predictive retention-activity relationship models of tricyclic antidepressants by micellar liquid chromatography. J Med Chem 42:3154-62 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histamine H2 receptor
Name:Histamine H2 receptor
Synonyms:Gastric receptor I | H2R | HISTAMINE H2 | Histamine H2-Gs alpha S
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:40567.22
Organism:Cavia porcellus (domestic guinea pig)
Description:For the H2 receptor-binding assays, guinea pig striatum was used.
Residue:359
Sequence:
MAFNGTVPSFCMDFTVYKVTISVILIILILVTVAGNVVVCLAVGLNRRLRSLTNCFIVSL
AVTDLLLGLLVLPFSAIYQLSCKWSFSKVFCNIYTSLDVMLCTASILNLFMISLDRYCAV
TDPLRYPVLITPARVAISLVFIWVISITLSFLSIHLGWNSRNETSKDNDTIVKCKVQVNE
VYGLVDGLVTFYLPLLIMCITYFRIFKIAREQARRINHIGSWKAATIREHKATVTLAAVM
GAFIICWFPYFTVFVYRGLKGDDAVNEVFEDVVLWLGYANSALNPILYAALNRDFRTAYH
QLFCCRLASHNSHETSLRLNNSQLNRSQCQEPRWQEDKPLNLQVWSGTEVTAPQGATNR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50010859
n/a
NameBDBM50010859
Synonyms:CHEMBL11 | IMIPRAMINE HYDROCHLORIDE | IMIPRAMINE PAMOATE | Imipramin
TypeSmall organic molecule
Emp. Form.C19H24N2
Mol. Mass.280.4073
SMILESCN(C)CCCN1c2ccccc2CCc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: