| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Histamine H2 receptor |
|---|
| Ligand | BDBM50020712 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_85065 (CHEMBL692776) |
|---|
| IC50 | 660±n/a nM |
|---|
| Citation |  Quiñones-Torrelo, C; Sagrado, S; Villanueva-Camañas, RM; Medina-Hernández, MJ Development of predictive retention-activity relationship models of tricyclic antidepressants by micellar liquid chromatography. J Med Chem42:3154-62 (1999) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Histamine H2 receptor |
|---|
| Name: | Histamine H2 receptor |
|---|
| Synonyms: | Gastric receptor I | H2R | HISTAMINE H2 | HRH2 | HRH2_CAVPO | Histamine H2-Gs alpha S |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40567.22 |
|---|
| Organism: | Cavia porcellus (domestic guinea pig) |
|---|
| Description: | For the H2 receptor-binding assays, guinea pig striatum was used. |
|---|
| Residue: | 359 |
|---|
| Sequence: | MAFNGTVPSFCMDFTVYKVTISVILIILILVTVAGNVVVCLAVGLNRRLRSLTNCFIVSL
AVTDLLLGLLVLPFSAIYQLSCKWSFSKVFCNIYTSLDVMLCTASILNLFMISLDRYCAV
TDPLRYPVLITPARVAISLVFIWVISITLSFLSIHLGWNSRNETSKDNDTIVKCKVQVNE
VYGLVDGLVTFYLPLLIMCITYFRIFKIAREQARRINHIGSWKAATIREHKATVTLAAVM
GAFIICWFPYFTVFVYRGLKGDDAVNEVFEDVVLWLGYANSALNPILYAALNRDFRTAYH
QLFCCRLASHNSHETSLRLNNSQLNRSQCQEPRWQEDKPLNLQVWSGTEVTAPQGATNR
|
|
|
|---|
| BDBM50020712 |
|---|
| n/a |
|---|
| Name | BDBM50020712 |
|---|
| Synonyms: | 10,11-dihydro-5-(gamma-dimethylaminopropylidene)-5H-dibenzo(a,d)cycloheptene | 10,11-dihydro-N,N-dimethyl-5H-dibenzo(a,d)heptalene-Delta(5),gamma-propylamine | 3-(10,11-dihydro-5H-dibenzo(a,d)cyclohepten-5-ylidene)-N,N-dimethyl-1-propanamine | 3-(10,11-dihydro-5H-dibenzo[a,d][7]annulen-5-ylidene)-N,N-dimethylpropan-1-amine | 3-(10,11-dihydro-5H-dibenzo[a,d]cyclohepten-5-ylidene)-N,N-dimethylpropan-1-amine | 5-(3-dimethylaminopropylidene)-10,11-dihydro-5H-dibenzo(a,d)cycloheptatriene | 5-(3-dimethylaminopropylidene)-10,11-dihydro-5H-dibenzo(a,d)cycloheptene | 5-(gamma-dimethylaminopropylidene)-5H-dibenzo[a,d][1,4]cycloheptadiene | AMITRIPTYLINE | Amitriptylin | CHEMBL629 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H23N |
|---|
| Mol. Mass. | 277.4033 |
|---|
| SMILES | [#6]-[#7](-[#6])-[#6]-[#6]\[#6]=[#6]-1/c2ccccc2-[#6]-[#6]-c2ccccc-12 |
|---|
| Structure | 
|
|---|
Search and Browse
