| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Vitamin K-dependent protein C |
|---|
| Ligand | BDBM50080477 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_27853 (CHEMBL642278) |
|---|
| Ki | 7000±n/a nM |
|---|
| Citation |  Ewing, WR; Becker, MR; Manetta, VE; Davis, RS; Pauls, HW; Mason, H; Choi-Sledeski, YM; Green, D; Cha, D; Spada, AP; Cheney, DL; Mason, JS; Maignan, S; Guilloteau, JP; Brown, K; Colussi, D; Bentley, R; Bostwick, J; Kasiewski, CJ; Morgan, SR; Leadley, RJ; Dunwiddie, CT; Perrone, MH; Chu, V Design and structure-activity relationships of potent and selective inhibitors of blood coagulation factor Xa. J Med Chem42:3557-71 (1999) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Vitamin K-dependent protein C |
|---|
| Name: | Vitamin K-dependent protein C |
|---|
| Synonyms: | Activated protein C cofactor | Anticoagulant protein C | Apolipoprotein H | Autoprothrombin IIA | Blood coagulation factor XIV | Coagulation factor V | Coagulation factor V heavy chain | Coagulation factor V light chain | Endothelial protein C receptor | PROC | PROC_HUMAN | Proaccelerin, labile factor | Vitamin K-dependent protein C precursor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 52067.73 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 461 |
|---|
| Sequence: | MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEELRHSSLERECI
EEICDFEEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIGSFSC
DCRSGWEGRFCQREVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCHPAVK
FPCGRPWKRMEKKRSHLKRDTEDQEDQVDPRLIDGKMTRRGDSPWQVVLLDSKKKLACGA
VLIHPSWVLTAAHCMDESKKLLVRLGEYDLRRWEKWELDLDIKEVFVHPNYSKSTTDNDI
ALLHLAQPATLSQTIVPICLPDSGLAERELNQAGQETLVTGWGYHSSREKEAKRNRTFVL
NFIKIPVVPHNECSEVMSNMVSENMLCAGILGDRQDACEGDSGGPMVASFHGTWFLVGLV
SWGEGCGLLHNYGVYTKVSRYLDWIHGHIRDKEAPQKSWAP
|
|
|
|---|
| BDBM50080477 |
|---|
| n/a |
|---|
| Name | BDBM50080477 |
|---|
| Synonyms: | 3-[(S)-3-(Naphthalene-2-sulfonylamino)-2-oxo-pyrrolidin-1-ylmethyl]-benzamidine | 3-[3-((S)-Naphthalene-2-sulfonylamino)-2-oxo-pyrrolidin-1-ylmethyl]-benzamidine | CHEMBL93796 | RPR-118071 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H22N4O3S |
|---|
| Mol. Mass. | 422.5 |
|---|
| SMILES | NC(=N)c1cccc(CN2CC[C@H](NS(=O)(=O)c3ccc4ccccc4c3)C2=O)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
