Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase IV
LigandBDBM50080684
Substrate/Competitorn/a
Meas. Tech.ChEMBL_45427
Ki 0.80±n/a nM
Citation Scozzafava ABriganti FMincione GMenabuoni LMincione FSupuran CT Carbonic anhydrase inhibitors: synthesis of water-soluble, aminoacyl/dipeptidyl sulfonamides possessing long-lasting intraocular pressure-lowering properties via the topical route. J Med Chem 42:3690-700 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic Anhydrase IV
Name:Carbonic anhydrase
Synonyms:CA-IV | Carbonate dehydratase IV | Carbonic anhydrase 4
Type:Enzyme
Mol. Mass.:35152.74
Organism:Bos taurus (bovine)
Description:Bovine isozyme, isolated from lung microsomes
Residue:312
Sequence:
MRLLLALLVLAAAPPQARAASHWCYQIQVKPSNYTCLEPDEWEGSCQNNRQSPVNIVTAK
TQLDPNLGRFSFSGYNMKHQWVVQNNGHTVMVLLENKPSIAGGGLSTRYQATQLHLHWSR
AMDRGSEHSFDGERFAMEMHIVHEKEKGLSGNASQNQFAEDEIAVLAFMVEDGSKNVNFQ
PLVEALSDIPRPNMNTTMKEGVSLFDLLPEEESLRHYFRYLGSLTTPTCDEKVVWTVFQK
PIQLHRDQILAFSQKLFYDDQQKVNMTDNVRPVQSLGQRQVFRSGAPGLLLAQPLPTLLA
PVLACLTVGFLR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50080684
n/a
NameBDBM50080684
Synonyms:5-(4-aminophenylsulfonylimino)-4-methyl-4,5-dihydro-1,3,4-thiadiazole-2-sulfonamide | 5-[(Z)-4-Amino-benzenesulfonylimino]-4-methyl-4,5-dihydro-[1,3,4]thiadiazole-2-sulfonic acid amide | CHEMBL331083
TypeSmall organic molecule
Emp. Form.C9H11N5O4S3
Mol. Mass.349.41
SMILESCn1nc(s\c1=N/S(=O)(=O)c1ccc(N)cc1)S(N)(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: