| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Alpha-1A adrenergic receptor |
|---|
| Ligand | BDBM50082802 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_33739 (CHEMBL873186) |
|---|
| Ki | 0.70±n/a nM |
|---|
| Citation |  Nagarathnam, D; Miao, SW; Lagu, B; Chiu, G; Fang, J; Murali Dhar, TG; Zhang, J; Tyagarajan, S; Marzabadi, MR; Zhang, F; Wong, WC; Sun, W; Tian, D; Wetzel, JM; Forray, C; Chang, RS; Broten, TP; Ransom, RW; Schorn, TW; Chen, TB; O'Malley, S; Kling, P; Schneck, K; Bendesky, R; Harrell, CM Design and synthesis of novel alpha(1)(a) adrenoceptor-selective antagonists. 1. Structure-activity relationship in dihydropyrimidinones. J Med Chem42:4764-77 (1999) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Alpha-1A adrenergic receptor |
|---|
| Name: | Alpha-1A adrenergic receptor |
|---|
| Synonyms: | ADA1A_HUMAN | ADRA1A | ADRA1C | Adrenergic alpha1A | Alpha 1A-adrenoceptor | Alpha 1A-adrenoreceptor | Alpha adrenergic receptor 1a | Alpha-1C adrenergic receptor | Alpha-adrenergic receptor 1c | Cerebral cortex alpha adrenergic receptor | adrenergic Alpha1 | adrenergic Alpha1C |
|---|
| Type: | Cell-surface receptors |
|---|
| Mol. Mass.: | 51511.67 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P35348 |
|---|
| Residue: | 466 |
|---|
| Sequence: | MVFLSGNASDSSNCTQPPAPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSV
THYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTASIMGLCII
SIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINE
EPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN
APAGGSGMASAKTKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD
FKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLCRKQSSKHALGYTL
HPPSQAVEGQHKDMVRIPVGSRETFYRISKTDGVCEWKFFSSMPRGSARITVSKDQSSCT
TARVRSKSFLQVCCCVGPSTPSLDKNHQVPTIKVHTISLSENGEEV
|
|
|
|---|
| BDBM50082802 |
|---|
| n/a |
|---|
| Name | BDBM50082802 |
|---|
| Synonyms: | 1-(3-{[5-Carbamoyl-4-methyl-6-(4-nitro-phenyl)-2-oxo-3,6-dihydro-2H-pyrimidine-1-carbonyl]-amino}-propyl)-4-phenyl-piperidine-4-carboxylic acid methyl ester | CHEMBL145562 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H34N6O7 |
|---|
| Mol. Mass. | 578.6163 |
|---|
| SMILES | COC(=O)C1(CCN(CCCNC(=O)N2C(C(C(N)=O)=C(C)NC2=O)c2ccc(cc2)[N+]([O-])=O)CC1)c1ccccc1 |t:19| |
|---|
| Structure | 
|
|---|
Search and Browse
