Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M1
LigandBDBM50073454
Substrate/Competitorn/a
Meas. Tech.ChEMBL_138287
IC50 15±n/a nM
Citation Augelli-Szafran CEBlankley CJJaen JCMoreland DWNelson CBPenvose-Yi JRSchwarz RDThomas AJ Identification and characterization of m1 selective muscarinic receptor antagonists1. J Med Chem 42:356-63 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor M1
Name:Muscarinic acetylcholine receptor M1 and M3
Synonyms:CHRM1 | Cholinergic receptor, muscarinic 1 | Cholinergic, muscarinic M1
Type:Protein
Mol. Mass.:51442.54
Organism:Homo sapiens (Human)
Description:P11229
Residue:460
Sequence:
MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVN
NYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS
FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYI
QFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSS
SERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEV
VIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKE
KKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYAL
CNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50073454
n/a
NameBDBM50073454
Synonyms:1-Ethyl-4-phenyl-1,2,5,6-tetrahydro-pyridine-3-carboxylic acid cyclohexylmethyl ester; oxalic acid | CHEMBL121520
TypeSmall organic molecule
Emp. Form.C21H29NO2
Mol. Mass.327.4605
SMILESCCN1CCC(=C(C1)C(=O)OCC1CCCCC1)c1ccccc1 |c:5|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: