Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M4
LigandBDBM50073503
Substrate/Competitorn/a
Meas. Tech.ChEMBL_139113
IC50 62±n/a nM
Citation Augelli-Szafran CEBlankley CJJaen JCMoreland DWNelson CBPenvose-Yi JRSchwarz RDThomas AJ Identification and characterization of m1 selective muscarinic receptor antagonists1. J Med Chem 42:356-63 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor M4
Name:Muscarinic acetylcholine receptor M2 and M4
Synonyms:CHRM4 | Cholinergic, muscarinic M4 | Muscarinic acetylcholine receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:53079.31
Organism:Homo sapiens (Human)
Description:Cholinergic, muscarinic M4 CHRM4 HUMAN M3::P08173
Residue:479
Sequence:
MANFTPVNGSSGNQSVRLVTSSSHNRYETVEMVFIATVTGSLSLVTVVGNILVMLSIKVN
RQLQTVNNYFLFSLACADLIIGAFSMNLYTVYIIKGYWPLGAVVCDLWLALDYVVSNASV
MNLLIISFDRYFCVTKPLTYPARRTTKMAGLMIAAAWVLSFVLWAPAILFWQFVVGKRTV
PDNQCFIQFLSNPAVTFGTAIAAFYLPVVIMTVLYIHISLASRSRVHKHRPEGPKEKKAK
TLAFLKSPLMKQSVKKPPPGEAAREELRNGKLEEAPPPALPPPPRPVADKDTSNESSSGS
ATQNTKERPATELSTTEATTPAMPAPPLQPRALNPASRWSKIQIVTKQTGNECVTAIEIV
PATPAGMRPAANVARKFASIARNQVRKKRQMAARERKVTRTIFAILLAFILTWTPYNVMV
LVNTFCQSCIPDTVWSIGYWLCYVNSTINPACYALCNATFKKTFRHLLLCQYRNIGTAR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50073503
n/a
NameBDBM50073503
Synonyms:1-Ethyl-4-phenyl-1,2,5,6-tetrahydro-pyridine-3-carboxylic acid cyclohexyl ester; oxalic acid | CHEMBL332980
TypeSmall organic molecule
Emp. Form.C20H27NO2
Mol. Mass.313.4339
SMILESCCN1CCC(=C(C1)C(=O)OC1CCCCC1)c1ccccc1 |c:5|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: