Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCorticotropin releasing factor receptor
LigandBDBM50074411
Substrate/Competitorn/a
Meas. Tech.ChEMBL_51131
Ki 5±n/a nM
Citation Hodge CNAldrich PEWasserman ZRFernandez CHNemeth GAArvanitis ACheeseman RSChorvat RJCiganek EChristos TEGilligan PJKrenitsky PScholfield EStrucely P Corticotropin-releasing hormone receptor antagonists: framework design and synthesis guided by ligand conformational studies. J Med Chem 42:819-32 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Corticotropin releasing factor receptor
Name:Corticotropin releasing factor receptor
Synonyms:CRF-R | CRF1 | CRH-R 1 | CRHR1 | Corticotropin releasing factor receptor 1 | Corticotropin-releasing Factor Receptor 1 | Corticotropin-releasing hormone receptor 1
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:47870.75
Organism:Rattus norvegicus (rat)
Description:Receptor binding assays were performed using rat cortex homogenate.
Residue:415
Sequence:
MGRRPQLRLVKALLLLGLNPVSTSLQDQRCENLSLTSNVSGLQCNASVDLIGTCWPRSPA
GQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAV
IINYLGHCISLVALLVAFVLFLRLRSIRCLRNIIHWNLISAFILRNATWFVVQLTVSPEV
HQSNVAWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDRLRKWMFVCIGWGVPF
PIIVAWAIGKLHYDNEKCWFGKRPGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRA
STTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVS
VFYCFLNSEVRSAIRKRWRRWQDKHSIRARVARAMSIPTSPTRVSFHSIKQSTAV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50074411
n/a
NameBDBM50074411
Synonyms:(2-Bromo-4,6-dimethoxy-phenyl)-(4,6-dimethyl-pyrimidin-2-yl)-ethyl-amine | CHEMBL46479
TypeSmall organic molecule
Emp. Form.C16H20BrN3O2
Mol. Mass.366.253
SMILESCCN(c1nc(C)cc(C)n1)c1c(Br)cc(OC)cc1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: