Reaction Details |
| Report a problem with these data |
Target | 5-hydroxytryptamine receptor 1A |
---|
Ligand | BDBM10755 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1105 (CHEMBL616428) |
---|
Ki | 7.3±n/a nM |
---|
Citation | Cappelli, A; Anzini, M; Vomero, S; Canullo, L; Mennuni, L; Makovec, F; Doucet, E; Hamon, M; Menziani, MC; De Benedetti, PG; Bruni, G; Romeo, MR; Giorgi, G; Donati, A Novel potent and selective central 5-HT3 receptor ligands provided with different intrinsic efficacy. 2. Molecular basis of the intrinsic efficacy of arylpiperazine derivatives at the central 5-HT3 receptors. J Med Chem42:1556-75 (1999) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
5-hydroxytryptamine receptor 1A |
---|
Name: | 5-hydroxytryptamine receptor 1A |
Synonyms: | 5-HT-1A | 5-HT1 | 5-HT1A | 5-Hydroxytryptamine receptor 1A (5-HT1A) | 5-hydroxytryptamine receptor 1A (5HT1A) | 5HT1A_RAT | 5ht1a | G-21 | Htr1a | Serotonin 1 (5-HT1) receptor | Serotonin 1a (5-HT1a) receptor/Adrenergic receptor alpha-1 | Serotonin receptor 1A |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 46445.29 |
Organism: | Rattus norvegicus (rat) |
Description: | Binding assays were performed using rat hippocampal membranes. |
Residue: | 422 |
Sequence: | MDVFSFGQGNNTTASQEPFGTGGNVTSISDVTFSYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVRKVEKKGAGT
SLGTSSAPPPKKSLNGQPGSGDWRRCAENRAVGTPCTNGAVRQGDDEATLEVIEVHRVGN
SKEHLPLPSESGSNSYAPACLERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP
FFIVALVLPFCESSCHMPALLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
RR
|
|
|
BDBM10755 |
---|
n/a |
---|
Name | BDBM10755 |
Synonyms: | 14C-5-hydroxy tryptamine creatinine disulfate | 2-imino-1-methylimidazolidin-4-one; 3-(2-aminoethyl)-1H-indol-5-ol; bis(sulfuric acid) | 5-HT | 5-Hydroxy Tryptamine | 5-hydroxy tryptamine creatinine disulfate | CHEMBL535832 | Serotonin | [3H]-5-HT |
Type | Small organic molecule |
Emp. Form. | C10H12N2O |
Mol. Mass. | 176.2151 |
SMILES | NCCc1c[nH]c2ccc(O)cc12 |
Structure |
|